PTM Viewer PTM Viewer

AT1G56010.1

Arabidopsis thaliana [ath]

NAC domain containing protein 1

No PTMs currently found

PLAZA: AT1G56010
Gene Family: HOM05D000010
Other Names: ANAC022,Arabidopsis NAC domain containing protein 22,anac021,Arabidopsis NAC domain containing protein 21; NAC1
No Uniprot reference stored for this protein

Link out to other resources with this protein ID : TAIR   |   PeptideAtlas   |   ARAPORT   |   PhosPhAt

PTMs

There are no stored PTMs for this protein

Sequence

Length: 257

MACVGGKDWYFYSQRDRKYATGLRTNRATATGYWKATGKDRTILRKGKLVGMRKTLVFYQGRAPRGRKTDWVMHEFRLQGSHHPPNHSLSSPKEDWVLCRVFHKNTEGVICRDNMGSCFDETASASLPPLMDPYINFDQEPSSYLSDDHHYIINEHVPCFSNLSQNQTLNSNLTNSVSELKIPCKNPNPLFTGGSASATLTGLDSFCSSDQMVLRALLSQLTKIDGSLGPKESQSYGEGSSESLLTDIGIPSTVWNC

No domains or active sites found for this protein.

BLAST


Perform a BLAST search for this sequence, or a part of this sequence (minimum 50 characters)
A downloadable tutorial can be found here